| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EF041506.1 | complete | 241 | 1-726(+) |
Amino Acid sequence : | |||
| MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGTPKTLERYQRCCYTSQDSTIADRETQSWYQEVSKLKAKFESLQRSQRHLLGEDLGPLSV KELQQLERQLESSLSQARQRKTQIMLDQMEELRKKERHLGELNNQLKNKLETEGSTFRAIQGSWESNGGVGNNAFPFHPSQSSAMDCEPTLQIGYHHLVQPETVLPRISEGENNFMVGWV L* | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,650.025 | ||
| Theoretical pI: | 8.999 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 45.367 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.725 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.237 | ||
| sheet | 0.278 | ||