Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF041506.1 | complete | 241 | 1-726(+) |
Amino Acid sequence : | |||
MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFGSAGTPKTLERYQRCCYTSQDSTIADRETQSWYQEVSKLKAKFESLQRSQRHLLGEDLGPLSV KELQQLERQLESSLSQARQRKTQIMLDQMEELRKKERHLGELNNQLKNKLETEGSTFRAIQGSWESNGGVGNNAFPFHPSQSSAMDCEPTLQIGYHHLVQPETVLPRISEGENNFMVGWV L* | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 27,650.025 | ||
Theoretical pI: | 8.999 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
Instability index: | 45.367 | ||
aromaticity | 0.071 | ||
GRAVY | -0.725 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.237 | ||
sheet | 0.278 |