Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF395203.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
IVFSATGKFFEFASSSMDDIVGKYKLHSASLEQPSLNLQLEDSSNKRLSKEVSDKTRELRQMRGEELEGLSLEELQQIEKRLEAGLKRVVEIKGTRFVNEITELQRKRAELMEENKQLKQ KLSLQTDMDCMVMEEGQSSESIITTNNICSSNSGPSPEDASLKLGQPL | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,942.229 | ||
Theoretical pI: | 5.047 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 65.988 | ||
aromaticity | 0.036 | ||
GRAVY | -0.651 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.244 | ||
sheet | 0.327 |