Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF502044.1 | complete | 211 | 1-636(+) |
Amino Acid sequence : | |||
MATLHLLCVIPHPASRKRHEPFRPKRDSSCPKKPAGRKKFRETRHPVYRGVRLRKSGKWVCEVREPNKKSRIWLGTFLTAEIAARAHDVAAIALRGKSACLNFADSAWRLRIPETTCPKE IQKAAAEAAVAFQAELNDTTADHGLDVEETIVEAIFTEESSEGFYMDEEFMFGMPTLWASMAEGMLLPPPSVQFGPNYDFDGDADVSPLEY* | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 23,693.814 | ||
Theoretical pI: | 6.605 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 53.408 | ||
aromaticity | 0.090 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.204 | ||
sheet | 0.308 |