Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF535583.1 | complete | 293 | 73-954(+) |
Amino Acid sequence : | |||
MSVENLQLPAGFRFHPTDEELVIYYLCRKCAALPLDVPIIADIDLYKFDPWELPSLALYGEKEWYFFSPRERKYPNGSRPSRAAGSGYWKATGADKPVGIPKPLATKKALVFYVGKAPKG EKTNWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYKKKGIEPERKPAGSKFLRPNPSLNPYPIPTSSETKPDIFASVPSVRAPGMNGMFYFDTSDSMPRLYADSSCSEHVLSPEFTCDT REAESQPSWGEVEGAHGGPTFKGDATESVSFPTTCNGFADPFHDIVKYLQKPF* | |||
Physicochemical properties | |||
Number of amino acids: | 293 | ||
Molecular weight: | 18,163.865 | ||
Theoretical pI: | 10.691 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 82.982 | ||
aromaticity | 0.034 | ||
GRAVY | -0.801 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.420 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF535583.1 | complete | 174 | 631-107(-) |
Amino Acid sequence : | |||
MSGSGTGSDSDSGGGISTQQASSRAQCPSSCRSGTAPSHQGGGCSSFGPTDPRQQAGTRALSSWSFLPWEPCRRRTPAPSLLRAVSGSQPVYQRPLPSSSPTRQPGLAETRWDISSPSAR RSTTLSPHTKPNLEAPMDRTCKDRCLQLSAHRGVAPHISGIGSKSPTPHRSGGT* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,163.865 | ||
Theoretical pI: | 10.691 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18365 | ||
Instability index: | 82.982 | ||
aromaticity | 0.034 | ||
GRAVY | -0.801 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.420 | ||
sheet | 0.155 |