Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF590480.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
QAALDSGALAIAEGGGKIISIDNDKILFSGNGDTLRIPLVMYQRSNKNTCMHQKPRVQQGKWIKKGQILADGAATVGGELALGKNVLVVYMPWEGYNFEDAVLISERLVYEDVYTSFHIR KYEIQTHVTSQGPERITNQIPHLEGHLLRNLDKN | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,160.373 | ||
Theoretical pI: | 7.147 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 29.556 | ||
aromaticity | 0.071 | ||
GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.234 | ||
sheet | 0.240 |