| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EF590480.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
| QAALDSGALAIAEGGGKIISIDNDKILFSGNGDTLRIPLVMYQRSNKNTCMHQKPRVQQGKWIKKGQILADGAATVGGELALGKNVLVVYMPWEGYNFEDAVLISERLVYEDVYTSFHIR KYEIQTHVTSQGPERITNQIPHLEGHLLRNLDKN | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,160.373 | ||
| Theoretical pI: | 7.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 29.556 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.234 | ||
| sheet | 0.240 | ||