Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EF590579.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
YYTPQYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEESQFIAYVAYPLDLFEXGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPA YSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTK | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,522.929 | ||
Theoretical pI: | 7.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 32.082 | ||
aromaticity | 0.119 | ||
GRAVY | -0.283 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.237 | ||
sheet | 0.237 |