| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EF590961.1 | internal | 127 | 3-383(+) |
Amino Acid sequence : | |||
| IETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDLAPGGLLASVYHLTRIESGVDQPEEVCIKIFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKD YIAPNFY | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 15,015.037 | ||
| Theoretical pI: | 6.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 63.002 | ||
| aromaticity | 0.150 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.228 | ||
| sheet | 0.213 | ||