Acc_NO	ORF type	length	start-end position (strand +/-)
>EF590961.1	internal	127	3-383(+)
Amino Acid sequence :
IETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDLAPGGLLASVYHLTRIESGVDQPEEVCIKIFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKD YIAPNFY
Physicochemical properties
Number of amino acids:		127
Molecular weight:		15,015.037
Theoretical pI:		6.329
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		42400 42525
Instability index:		63.002
aromaticity		0.150
GRAVY		-0.265
Secondary Structure Fraction
Helix		0.394
turn		0.228
sheet		0.213