Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU081817.1 | 5prime_partial | 196 | 1-591(+) |
Amino Acid sequence : | |||
SDPLCKPFSMGRNLLCVYSKKHMNDDPELAEMKKRANTRSLKEMALLLRGGSKIIWIAPSGGRDRPDPVTKEWYPAPFDASATDNMRRLVQHAGVPGHIYPLAILCHDIMPPPAQVEKNI GEKRVVSFHGAGISVAPKIDFHEVAGALEDPEAKMVYTKAIYDSVSQQYNVLNSAIHGKQGLEASTPSVSLSQPWQ* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,586.547 | ||
Theoretical pI: | 8.385 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 48.366 | ||
aromaticity | 0.066 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.270 | ||
sheet | 0.255 |