Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU108699.1 | complete | 265 | 1-798(+) |
Amino Acid sequence : | |||
MASVKKLAGKVAIVTGGASGIGEVIARLFAERGARAVVIADMQPEKGGTVAESIGGRRCSYVHCDITDEEQVRSVVDWTAATYGGVDVMFCNAGTASATAQTVLDLDLAQFDRVMRVNAR GTAACVKQAARKMVELGRGGAIICTASATANHAGPNLTDYIMSKRGVLGLVRSASLQLGVHGIRVNSVSPTALATPLTATIGLRTAADVESFYGQVTSLKGVAITAEHVAEAVAFLASDE AAFVTGHDLAVDGGLQCLPFVAVAK* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 21,206.385 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 95.345 | ||
aromaticity | 0.027 | ||
GRAVY | -1.835 | ||
Secondary Structure Fraction | |||
Helix | 0.121 | ||
turn | 0.242 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU108699.1 | 5prime_partial | 182 | 3-551(+) |
Amino Acid sequence : | |||
GKREEARRQGSHRNRRRQRHRRGHRPPLRRARRTRGGDRRHAAREGRYRGGIHRWPAVQLRPLRYHRRGTGQVRRGLDRRHLRRRRRDVLQRRHRQRHRSDRPGPGPGAVRPRHARQRPR HGGVREAGGAEDGGAGEGRRYHLHRQRDGEPRRSQLDGLHHVEARGAGAGAVGEFTTGGARD* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 21,206.385 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 95.345 | ||
aromaticity | 0.027 | ||
GRAVY | -1.835 | ||
Secondary Structure Fraction | |||
Helix | 0.121 | ||
turn | 0.242 | ||
sheet | 0.181 |