Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU108700.1 | complete | 314 | 1-945(+) |
Amino Acid sequence : | |||
MAEVQRYALVTGANKGVGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQ ALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKEGKLEESQWPPHFAAERV SKAALNAYTKIAAKKYPSFRINAICPGYAKTDITFHAGPLSVAEAAQVPVKLALLPDGGPSGCFFPRDKALALY* | |||
Physicochemical properties | |||
Number of amino acids: | 314 | ||
Molecular weight: | 11,230.688 | ||
Theoretical pI: | 9.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.931 | ||
aromaticity | 0.105 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.333 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU108700.1 | 5prime_partial | 126 | 945-565(-) |
Amino Acid sequence : | |||
LIESQSFVSREEAAGGPPIRQQSQLHRNLSSFGHTQWARMEGNVGFRITRAYCIYAETRVLLRRNLSVCVQRRLRNSFRRKMWRPLAFFKLTFFYIFEKNLHDFVHSLFCQPVLVAQHSL CPFVPQ* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 11,230.688 | ||
Theoretical pI: | 9.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.931 | ||
aromaticity | 0.105 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.333 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU108700.1 | complete | 105 | 782-465(-) |
Amino Acid sequence : | |||
MRKLGYFFAAILVYAFNAAFETLSAAKCGGHWLSSSLPSFISLRKTSTTSSTLSSVSLSSSPNTPFAHSFHSSSKLPKEEETLTILGEGDSCKRGMRACVSLFGP* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,230.688 | ||
Theoretical pI: | 9.218 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 55.931 | ||
aromaticity | 0.105 | ||
GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.333 | ||
sheet | 0.267 |