| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EU110282.1 | internal | 122 | 2-367(+) |
Amino Acid sequence : | |||
| EKITRLIEYATNRSIPVIIVCASGGARMQEGSLSLMQMAKVSSALYNYQSKKKLFYVSILTSPTTGGVTASFGMLGDVIIAEPNAYVAFAGKRVIEQTLNKLVPDGSQAAEYSFHKGLFD PI | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,182.123 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
| Instability index: | 45.488 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EU110282.1 | internal | 122 | 2-367(+) |
Amino Acid sequence : | |||
| EKITRLIEYATNRSIPVIIVCASGGARMQEGSLSLMQMAKVSSALYNYQSKKKLFYVSILTSPTTGGVTASFGMLGDVIIAEPNAYVAFAGKRVIEQTLNKLVPDGSQAAEYSFHKGLFD PI | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,182.123 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
| Instability index: | 45.488 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.262 | ||