Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU139474.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
PFHRYYLYFFERILGKLIDDPTFAMPFWNWDSPAGMQIPSLYTNPNSALYDRFRDKAHQPPAVVNLNFSGDANTTADQQMKTNLTVMYRQMVSNSKTPRLFFGSPYRRGEDPNPGSGSIE GIPHGPVHVWTGDSTQPNT | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,994.770 | ||
Theoretical pI: | 11.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 101.788 | ||
aromaticity | 0.051 | ||
GRAVY | -1.067 | ||
Secondary Structure Fraction | |||
Helix | 0.239 | ||
turn | 0.275 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU139474.1 | internal | 139 | 417-1(-) |
Amino Acid sequence : | |||
CIRLGAVSGPDMNRAVRDTLDRTGSRVGILAAAVRTAEEKTGSLRVGHHLPVHYRQVCLHLLIGGGVRVAAEVEIDDGRRLMRLVAKPVVQGGVRVGVERRDLHTGGGIPVPEGHGEGGI VDQLPQDSLEEVEIISVEG | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,994.770 | ||
Theoretical pI: | 11.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 101.788 | ||
aromaticity | 0.051 | ||
GRAVY | -1.067 | ||
Secondary Structure Fraction | |||
Helix | 0.239 | ||
turn | 0.275 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU139474.1 | internal | 138 | 3-416(+) |
Amino Acid sequence : | |||
LPQILSLLLRENLGEADRRSHLRHALLELGFPRRYADPVSLHQPELRLVRPVSRQGASAAGRRQSQLQRRREHHRRSANEDKLDGNVQANGVQLEDSPSFLRQSLPPRRGSQPWIRFDRG YPSRPGSCLDRRQHPTEY | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,994.770 | ||
Theoretical pI: | 11.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 101.788 | ||
aromaticity | 0.051 | ||
GRAVY | -1.067 | ||
Secondary Structure Fraction | |||
Helix | 0.239 | ||
turn | 0.275 | ||
sheet | 0.254 |