Acc_NO	ORF type	length	start-end position (strand +/-)
>EU311204.1	internal	233	3-701(+)
Amino Acid sequence :
ASVGFKAGVKDYRLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIDPVLGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFK ALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKAQAETGEIKGHYLN
Physicochemical properties
Number of amino acids:		233
Molecular weight:		26,076.181
Theoretical pI:		7.036
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38850 39100
Instability index:		28.282
aromaticity		0.124
GRAVY		-0.401
Secondary Structure Fraction
Helix		0.309
turn		0.223
sheet		0.236