Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU371558.1 | internal | 165 | 2-496(+) |
Amino Acid sequence : | |||
YKGLCYHLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDF TKDDENVNSQPFMRWRDRFLFCAEALFKAQAETGEIKGHYLNATS | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,685.131 | ||
Theoretical pI: | 8.329 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
Instability index: | 28.123 | ||
aromaticity | 0.127 | ||
GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.218 | ||
sheet | 0.273 |