Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU424138.1 | complete | 239 | 105-824(+) |
Amino Acid sequence : | |||
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSSSSILKTLERYQKCSYGAPDNNVQIRETQLLQSSHQEYLKLKARVEALQRSQRNLLGEDLG PLSSKELEQLERQLDSSLKQIRSTRTQCMLDQLGDLQRKEHMLCEANRSLRKTLEESNQANHQQVWESNANAIAYDRQANQQREEFYQPLDCQPTLHIGFQGDQMAGPSVTTYMPGWLQ* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 27,609.968 | ||
Theoretical pI: | 8.860 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 55.518 | ||
aromaticity | 0.063 | ||
GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.209 | ||
sheet | 0.293 |