Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU482410.2 | complete | 159 | 38-517(+) |
Amino Acid sequence : | |||
MILFFRAFSILIIISFLIFVGAEARTLLGNHGGMLKLKKGSIGNYGRNRPYITPSPPEASPSTKQEIVNGRHDHVLPPPSPKHEPIIGQLTTSTSTSPDQDHDHEEAAAAFIIIRVGGRH DHVPAPPAPKPEDEQGQIIITTSSTMNINQHYLPLQASY* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 17,386.583 | ||
Theoretical pI: | 6.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 59.221 | ||
aromaticity | 0.063 | ||
GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.302 | ||
sheet | 0.208 |