Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU622047.1 | complete | 154 | 151-615(+) |
Amino Acid sequence : | |||
MSPRLMRVLVNSNFFIEEKNSSNQEVHYWLTPASRLLLKGAPLTVAPLVQVILDPTFTNPWHHMSEWFTHEHHATQFEAANGCMFWEKLANEPSMGRFFDEAMSCDARLVAHVLTKDYKH VIGGIRTLVDVGGGDGTMAKAILEAAAHHKMHSY* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,386.744 | ||
Theoretical pI: | 6.393 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 48.618 | ||
aromaticity | 0.097 | ||
GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.208 | ||
sheet | 0.305 |