Acc_NO	ORF type	length	start-end position (strand +/-)
>EU626400.1	internal	116	349-2(-)
Amino Acid sequence :
VSFLRLLICLTQRVIPPDLGSRRIHRGSVRFVLVRPNERGVFRVFSTTECHGTDRPGLMFGPTTISKFMGSHFPLPIHEPHKREVRERRCVTPRQTCPRPEGFGRNLRSKTRWFTG
Physicochemical properties
Number of amino acids:		116
Molecular weight:		13,466.563
Theoretical pI:		11.672
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		58.304
aromaticity		0.086
GRAVY		-0.490
Secondary Structure Fraction
Helix		0.284
turn		0.259
sheet		0.147