Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU643743.1 | internal | 303 | 1-909(+) |
Amino Acid sequence : | |||
RSIHSIFPFLEDKFSHLTYVSDVQISYPIHLEKLVQTLRYWVKDTSSLHLLRFFLHEYWNWNSLIFPNNLISFFAKSNPRLFLFLYNSHVYEYESIFFFLRKQSFHLRSTFFRVLLERIY FFGKIEHFAEVFANDFQAILWLFKDPFMHYVRYQGKSILASKDTPLLLKKWKYYLVNLCQCHFSVWFQPAKICINPLSKQSLDFLGYLSSLRLNLSVVRSQMLENAFLIDNAMKKVDTRI PIIPLIRSLAKTKFCNAAGHPISQPIWAGSSDSDIINRFVRICRNLSHYYSGSSKKKSLYRIK | |||
Physicochemical properties | |||
Number of amino acids: | 303 | ||
Molecular weight: | 36,109.702 | ||
Theoretical pI: | 9.750 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 62340 62590 | ||
Instability index: | 35.384 | ||
aromaticity | 0.172 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.426 | ||
turn | 0.218 | ||
sheet | 0.208 |