Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU677013.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPF | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,513.278 | ||
Theoretical pI: | 8.308 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 22.469 | ||
aromaticity | 0.119 | ||
GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.223 | ||
sheet | 0.228 |