Acc_NO	ORF type	length	start-end position (strand +/-)
>EU677015.1	internal	205	2-616(+)
Amino Acid sequence :
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRW
Physicochemical properties
Number of amino acids:		205
Molecular weight:		22,986.870
Theoretical pI:		8.634
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35870 35995
Instability index:		24.713
aromaticity		0.122
GRAVY		-0.391
Secondary Structure Fraction
Helix		0.317
turn		0.220
sheet		0.229