Acc_NO	ORF type	length	start-end position (strand +/-)
>EU701225.1	internal	218	2-655(+)
Amino Acid sequence :
DIGTLYFIFGAIAGVMGTCFSVLIRMELARPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMIGGSGNWSVPILIGAPDMAFPRLNNISFWLLPPSLLLLLSSALVEVGSGTGWTVYPP LSGITSHSGGAVDLAISSLHLSGVSSILGSINFITTIFNMRGPGMTMHRSPLFVWSVLVTAFPLLLSLPVLAGAITMLLTDRNFNTTFSDPAGGGDPI
Physicochemical properties
Number of amino acids:		218
Molecular weight:		23,067.910
Theoretical pI:		5.862
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26470
Instability index:		32.331
aromaticity		0.096
GRAVY		0.783
Secondary Structure Fraction
Helix		0.390
turn		0.321
sheet		0.271