Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EU749405.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
SSLHLLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLM NKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNIFH YYSGS | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 29,044.307 | ||
Theoretical pI: | 9.580 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 37.700 | ||
aromaticity | 0.180 | ||
GRAVY | -0.037 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.237 | ||
sheet | 0.184 |