Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142508.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
ATSPTRHPCSAHQVMYELRVYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVGGGLVY GTKEGKLRVLQFYGSQDASCKETNHFLEESMLES* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,044.267 | ||
Theoretical pI: | 5.776 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
Instability index: | 47.751 | ||
aromaticity | 0.078 | ||
GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.214 | ||
sheet | 0.286 |