Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142512.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
VSMVPNGLQIPRLRDRLVKIVTDYRTETSLRQGCNDILKTDCINLLVKYYKEARRAVYLSSIEEETRGNIGGNASNQDTESATQTKAMELKSKTRGGGRCCLCFDPFSIQNISVIVFFCC HAYHASCLMEGSDSIDTDNTEVTRSD | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,313.295 | ||
Theoretical pI: | 6.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7950 | ||
Instability index: | 47.518 | ||
aromaticity | 0.062 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.226 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142512.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
VSMVPNGLQIPRLRDRLVKIVTDYRTETSLRQGCNDILKTDCINLLVKYYKEARRAVYLSSIEEETRGNIGGNASNQDTESATQTKAMELKSKTRGGGRCCLCFDPFSIQNISVIVFFCC HAYHASCLMEGSDSIDTDNTEVTRSD | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,313.295 | ||
Theoretical pI: | 6.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7950 | ||
Instability index: | 47.518 | ||
aromaticity | 0.062 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.226 | ||
sheet | 0.205 |