| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142512.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
| VSMVPNGLQIPRLRDRLVKIVTDYRTETSLRQGCNDILKTDCINLLVKYYKEARRAVYLSSIEEETRGNIGGNASNQDTESATQTKAMELKSKTRGGGRCCLCFDPFSIQNISVIVFFCC HAYHASCLMEGSDSIDTDNTEVTRSD | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,313.295 | ||
| Theoretical pI: | 6.163 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7950 | ||
| Instability index: | 47.518 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.226 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142512.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
| VSMVPNGLQIPRLRDRLVKIVTDYRTETSLRQGCNDILKTDCINLLVKYYKEARRAVYLSSIEEETRGNIGGNASNQDTESATQTKAMELKSKTRGGGRCCLCFDPFSIQNISVIVFFCC HAYHASCLMEGSDSIDTDNTEVTRSD | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,313.295 | ||
| Theoretical pI: | 6.163 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7950 | ||
| Instability index: | 47.518 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.226 | ||
| sheet | 0.205 | ||