| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142518.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVA | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,522.632 | ||
| Theoretical pI: | 5.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 51.892 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.295 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142518.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVA | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,522.632 | ||
| Theoretical pI: | 5.263 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 51.892 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.295 | ||
| sheet | 0.242 | ||