| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142522.1 | internal | 161 | 3-485(+) |
Amino Acid sequence : | |||
| TRLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGYTFGAGMFE MEEVKGGSPYGSGTFAGDGSRTPTDLELKQAFHQGQYFANI | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 17,218.310 | ||
| Theoretical pI: | 5.256 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 38.645 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.261 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142522.1 | internal | 161 | 3-485(+) |
Amino Acid sequence : | |||
| TRLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGYTFGAGMFE MEEVKGGSPYGSGTFAGDGSRTPTDLELKQAFHQGQYFANI | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 17,218.310 | ||
| Theoretical pI: | 5.256 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 38.645 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.261 | ||
| sheet | 0.273 | ||