Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142533.1 | complete | 118 | 55-411(+) |
Amino Acid sequence : | |||
MARQVALCTILVIAAVLFISSPRAESAVSCSTVASAISPCIGYVRGQGALTGACCSGVKGLAAAAATTPDRRTACSCLKSMAGKISGLNPSLAKGLPGKCGASVPYVISTSTDCTKVA* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,611.565 | ||
Theoretical pI: | 9.254 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
Instability index: | 42.828 | ||
aromaticity | 0.025 | ||
GRAVY | 0.602 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.280 | ||
sheet | 0.271 |