| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142537.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
| HEAGEKVYHFDDVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILI LVLAFGVRHFT | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,608.250 | ||
| Theoretical pI: | 4.996 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 26.453 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.214 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142537.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
| HEAGEKVYHFDDVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMDKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILI LVLAFGVRHFT | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,608.250 | ||
| Theoretical pI: | 4.996 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 26.453 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.214 | ||
| sheet | 0.198 | ||