| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142538.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| FVGEWLEWLYADVMQRLQAGDFSTLPEAHACTAGLKSLTTTITADGIEECRKLCGGHGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSLLGSGKKPVGTTSYMNRAEHLM QCRSGVCKVEDWLEPSAIVEAFEARAVRLAVSSAQNVSEASSPEQGFMEHSAD | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,725.120 | ||
| Theoretical pI: | 4.974 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 44.684 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.220 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142538.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| FVGEWLEWLYADVMQRLQAGDFSTLPEAHACTAGLKSLTTTITADGIEECRKLCGGHGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSLLGSGKKPVGTTSYMNRAEHLM QCRSGVCKVEDWLEPSAIVEAFEARAVRLAVSSAQNVSEASSPEQGFMEHSAD | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,725.120 | ||
| Theoretical pI: | 4.974 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 44.684 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.220 | ||
| sheet | 0.324 | ||