Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142548.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
GRRERETIMALRAAVNRIPLNRPLHAVTSSRIVRSSPSYCPRVVFRCQSGIPSEAKMEPMTELKYKNNASERWKIKMLYDGDCPLCMREVNMLRERNKSYGAIKFVDISSKDYSPEENEG LDYKTVMGRIHAILSDGTVVQDVEAFRRLYEVVGLGWVYAITKYEP | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,111.851 | ||
Theoretical pI: | 9.192 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
Instability index: | 57.177 | ||
aromaticity | 0.084 | ||
GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.229 | ||
sheet | 0.253 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142548.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
GRRERETIMALRAAVNRIPLNRPLHAVTSSRIVRSSPSYCPRVVFRCQSGIPSEAKMEPMTELKYKNNASERWKIKMLYDGDCPLCMREVNMLRERNKSYGAIKFVDISSKDYSPEENEG LDYKTVMGRIHAILSDGTVVQDVEAFRRLYEVVGLGWVYAITKYEP | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,111.851 | ||
Theoretical pI: | 9.192 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
Instability index: | 57.177 | ||
aromaticity | 0.084 | ||
GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.229 | ||
sheet | 0.253 |