| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142553.1 | internal | 125 | 3-377(+) |
Amino Acid sequence : | |||
| IKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVSVSPCSHIGGHKYAGNVI IFSPN | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,869.652 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 50.545 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.248 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142553.1 | internal | 125 | 3-377(+) |
Amino Acid sequence : | |||
| IKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVSVSPCSHIGGHKYAGNVI IFSPN | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,869.652 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 50.545 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.248 | ||
| sheet | 0.192 | ||