Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142556.1 | internal | 154 | 462-1(-) |
Amino Acid sequence : | |||
HWFIDSGSQAPEMSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRV LARAEVSPGKLRLGVEVDRKSWRNGQRSKGSHRS | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 13,317.317 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 73.091 | ||
aromaticity | 0.023 | ||
GRAVY | -1.147 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.383 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142556.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
DLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKEKDEEEEESRWHRVERSSGKFTRRFRLPENAKLDRVKATMEN GVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 13,317.317 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 73.091 | ||
aromaticity | 0.023 | ||
GRAVY | -1.147 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.383 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142556.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
RPVGPLRSLSVPPRLPVDFHSESQLPRRDLRSGQHTCGLEGDAQGARVQGRPPGDQEGGGEGRGGGGESPPDQRREEKGEGRGGGGVPVAPGREEQRKVYAKIPAAGECETGSGEGYDGE RSAHCHCG* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,317.317 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 73.091 | ||
aromaticity | 0.023 | ||
GRAVY | -1.147 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.383 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142556.1 | internal | 154 | 462-1(-) |
Amino Acid sequence : | |||
HWFIDSGSQAPEMSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRV LARAEVSPGKLRLGVEVDRKSWRNGQRSKGSHRS | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 13,317.317 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 73.091 | ||
aromaticity | 0.023 | ||
GRAVY | -1.147 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.383 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142556.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
DLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKEKDEEEEESRWHRVERSSGKFTRRFRLPENAKLDRVKATMEN GVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 13,317.317 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 73.091 | ||
aromaticity | 0.023 | ||
GRAVY | -1.147 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.383 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142556.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
RPVGPLRSLSVPPRLPVDFHSESQLPRRDLRSGQHTCGLEGDAQGARVQGRPPGDQEGGGEGRGGGGESPPDQRREEKGEGRGGGGVPVAPGREEQRKVYAKIPAAGECETGSGEGYDGE RSAHCHCG* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,317.317 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 73.091 | ||
aromaticity | 0.023 | ||
GRAVY | -1.147 | ||
Secondary Structure Fraction | |||
Helix | 0.133 | ||
turn | 0.383 | ||
sheet | 0.211 |