Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142564.1 | internal | 213 | 1-639(+) |
Amino Acid sequence : | |||
CKTLPINLVFSYVNDVSISGISSINSKFFHMMIYKCNNMDIRKITIDAPANSPNTDGIHVAGSSNVSIADSTIGTGDDCVSVGDNTKKLTITGVKCGPGHGISVGSLGKNPDEGDVVGFT VKNCVMTGTMNGIRIKTWKSKPSTAYSSLRLTDFTIENIVMNNVQNPIVIDQEYCPYSACPESAPSRIKISHVAFRNIRGTYSSDESIKLVCS | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 10,732.680 | ||
Theoretical pI: | 5.304 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 61.437 | ||
aromaticity | 0.091 | ||
GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.313 | ||
sheet | 0.253 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142564.1 | complete | 99 | 398-99(-) |
Amino Acid sequence : | |||
MPFMVPVMTQFFTVNPTTSPSSGFLPRLPTLMPWPGPHFTPVIVSFLVLSPTETQSSPVPMVESAILTLDDPATWIPSVLGLFAGASIVILRISMLLHL* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,732.680 | ||
Theoretical pI: | 5.304 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 61.437 | ||
aromaticity | 0.091 | ||
GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.313 | ||
sheet | 0.253 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142564.1 | internal | 213 | 1-639(+) |
Amino Acid sequence : | |||
CKTLPINLVFSYVNDVSISGISSINSKFFHMMIYKCNNMDIRKITIDAPANSPNTDGIHVAGSSNVSIADSTIGTGDDCVSVGDNTKKLTITGVKCGPGHGISVGSLGKNPDEGDVVGFT VKNCVMTGTMNGIRIKTWKSKPSTAYSSLRLTDFTIENIVMNNVQNPIVIDQEYCPYSACPESAPSRIKISHVAFRNIRGTYSSDESIKLVCS | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 10,732.680 | ||
Theoretical pI: | 5.304 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 61.437 | ||
aromaticity | 0.091 | ||
GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.313 | ||
sheet | 0.253 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142564.1 | complete | 99 | 398-99(-) |
Amino Acid sequence : | |||
MPFMVPVMTQFFTVNPTTSPSSGFLPRLPTLMPWPGPHFTPVIVSFLVLSPTETQSSPVPMVESAILTLDDPATWIPSVLGLFAGASIVILRISMLLHL* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,732.680 | ||
Theoretical pI: | 5.304 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 61.437 | ||
aromaticity | 0.091 | ||
GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.313 | ||
sheet | 0.253 |