| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142571.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
| EPSDSKNSLEVMEHKEAECQTPEGPILCINSCGFFGSAATMNMCSKCHKDLVLKQEQAKLAVASIDSIVNGGGCSSEKELIVVGSDAVVVGPVNPVTIGSEPSVGASSVAEDGEPKPKEG PSRCNTCRKRVGLTGFSCRCGHIFC | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,103.058 | ||
| Theoretical pI: | 5.379 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 625 | ||
| Instability index: | 47.678 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.324 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142571.1 | internal | 145 | 3-437(+) |
Amino Acid sequence : | |||
| EPSDSKNSLEVMEHKEAECQTPEGPILCINSCGFFGSAATMNMCSKCHKDLVLKQEQAKLAVASIDSIVNGGGCSSEKELIVVGSDAVVVGPVNPVTIGSEPSVGASSVAEDGEPKPKEG PSRCNTCRKRVGLTGFSCRCGHIFC | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,103.058 | ||
| Theoretical pI: | 5.379 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 625 | ||
| Instability index: | 47.678 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
| Helix | 0.221 | ||
| turn | 0.324 | ||
| sheet | 0.221 | ||