Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142583.1 | internal | 205 | 1-615(+) |
Amino Acid sequence : | |||
ERASSSKLLERLLSNPIHRTLAPSSSAVRSFNTNTAQMSSDGDSSSEGSSNIAHRRSDAPSRRRPGGLSRRRFRRGEDGDDEYYPAIFSGDVFDPRPSLSRVLNMMDRMMDLPVSVQRQR GWDAREEEDALHLRVDMPGLGKEHVRVSAEGSTLIIEGEREGEGEGEEDGERRRYRSRIELPDEVYRMDGIRAEMKNGVLKVTVP | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 13,267.554 | ||
Theoretical pI: | 11.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.310 | ||
aromaticity | 0.017 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.241 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142583.1 | 5prime_partial | 121 | 614-249(-) |
Amino Acid sequence : | |||
GTVTFSTPFFISALIPSILYTSSGSSMRLLYLLLSPSSSPSPSPSRSPSMISVLPSALTLTCSFPSPGMSTRRCSASSSSRASHPLCLCTDTGRSIIRSIMFRTRLRLGRGSNTSPEKMA G* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,267.554 | ||
Theoretical pI: | 11.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.310 | ||
aromaticity | 0.017 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.241 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142583.1 | 5prime_partial | 116 | 615-265(-) |
Amino Acid sequence : | |||
RHRHLQHPILHLCPDPIHPVHLIRQLNAASVPPPFTILLSLSLSLSLSLYDKRASLRTHPHVLLPQPRHVHAQMQRVLLLTCVPPPLPLHGHRKIHHPVHHVQNPAQARPRIKHVS* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,267.554 | ||
Theoretical pI: | 11.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.310 | ||
aromaticity | 0.017 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.241 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142583.1 | internal | 205 | 1-615(+) |
Amino Acid sequence : | |||
ERASSSKLLERLLSNPIHRTLAPSSSAVRSFNTNTAQMSSDGDSSSEGSSNIAHRRSDAPSRRRPGGLSRRRFRRGEDGDDEYYPAIFSGDVFDPRPSLSRVLNMMDRMMDLPVSVQRQR GWDAREEEDALHLRVDMPGLGKEHVRVSAEGSTLIIEGEREGEGEGEEDGERRRYRSRIELPDEVYRMDGIRAEMKNGVLKVTVP | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 13,267.554 | ||
Theoretical pI: | 11.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.310 | ||
aromaticity | 0.017 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.241 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142583.1 | 5prime_partial | 121 | 614-249(-) |
Amino Acid sequence : | |||
GTVTFSTPFFISALIPSILYTSSGSSMRLLYLLLSPSSSPSPSPSRSPSMISVLPSALTLTCSFPSPGMSTRRCSASSSSRASHPLCLCTDTGRSIIRSIMFRTRLRLGRGSNTSPEKMA G* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,267.554 | ||
Theoretical pI: | 11.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.310 | ||
aromaticity | 0.017 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.241 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142583.1 | 5prime_partial | 116 | 615-265(-) |
Amino Acid sequence : | |||
RHRHLQHPILHLCPDPIHPVHLIRQLNAASVPPPFTILLSLSLSLSLSLYDKRASLRTHPHVLLPQPRHVHAQMQRVLLLTCVPPPLPLHGHRKIHHPVHHVQNPAQARPRIKHVS* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,267.554 | ||
Theoretical pI: | 11.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.310 | ||
aromaticity | 0.017 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.241 | ||
sheet | 0.233 |