| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142584.1 | internal | 233 | 2-700(+) |
Amino Acid sequence : | |||
| HEEEWGFFQLVNHGIPKELLDRVKKVCSECYKLDRERKFKESEPVQLLNELVGSGETGGRVDDVDWEDVFVLQDNNEWPANPPEFKKTMKEYREELKKLAEKVMEVMEENLGLAKGHMKH SFSGTDAPFFGTKVSHYPPCPHPDKVNGLRAHTDAGGVILLFQDDEVSGLQILKDGEWIDVEPMADAIVINTGDQIEVLSSGKYKSVWHRVLAKADGNRRSIASFYNPSLTAA | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 17,437.271 | ||
| Theoretical pI: | 6.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 48.978 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.434 | ||
| turn | 0.151 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142584.1 | 3prime_partial | 152 | 457-2(-) |
Amino Acid sequence : | |||
| MGPEAVDFVRVRAGGVVADFRAEERRVRAGERMLHVPLCETEVLFHHFHYLLRELLQFFSVLLHGFFELRWICRPLVVILQYKHIFPVHVIDPTTGLAATDQLVQQLNGLGLLELSLPIQ LVALRANLLNAVEELFRNPVVHQLEESPLFLV | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,437.271 | ||
| Theoretical pI: | 6.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 48.978 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.434 | ||
| turn | 0.151 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142584.1 | internal | 233 | 2-700(+) |
Amino Acid sequence : | |||
| HEEEWGFFQLVNHGIPKELLDRVKKVCSECYKLDRERKFKESEPVQLLNELVGSGETGGRVDDVDWEDVFVLQDNNEWPANPPEFKKTMKEYREELKKLAEKVMEVMEENLGLAKGHMKH SFSGTDAPFFGTKVSHYPPCPHPDKVNGLRAHTDAGGVILLFQDDEVSGLQILKDGEWIDVEPMADAIVINTGDQIEVLSSGKYKSVWHRVLAKADGNRRSIASFYNPSLTAA | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 17,437.271 | ||
| Theoretical pI: | 6.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 48.978 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.434 | ||
| turn | 0.151 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142584.1 | 3prime_partial | 152 | 457-2(-) |
Amino Acid sequence : | |||
| MGPEAVDFVRVRAGGVVADFRAEERRVRAGERMLHVPLCETEVLFHHFHYLLRELLQFFSVLLHGFFELRWICRPLVVILQYKHIFPVHVIDPTTGLAATDQLVQQLNGLGLLELSLPIQ LVALRANLLNAVEELFRNPVVHQLEESPLFLV | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,437.271 | ||
| Theoretical pI: | 6.039 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 48.978 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.395 | ||
Secondary Structure Fraction | |||
| Helix | 0.434 | ||
| turn | 0.151 | ||
| sheet | 0.349 | ||