| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142587.1 | internal | 108 | 1-324(+) |
Amino Acid sequence : | |||
| ARVESGFGLGGPPCDRFGKGKIELCAFHGALVQDQRIHGGAALGPLGKYEGKMKGVADEAIFLGESCMLAFQPGPESRVHGGNLMAMLASSSEGHGAHTESSVGGGSS | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 10,927.220 | ||
| Theoretical pI: | 6.199 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 41.052 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.352 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142587.1 | internal | 108 | 1-324(+) |
Amino Acid sequence : | |||
| ARVESGFGLGGPPCDRFGKGKIELCAFHGALVQDQRIHGGAALGPLGKYEGKMKGVADEAIFLGESCMLAFQPGPESRVHGGNLMAMLASSSEGHGAHTESSVGGGSS | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 10,927.220 | ||
| Theoretical pI: | 6.199 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 41.052 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.352 | ||
| sheet | 0.296 | ||