| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142591.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
| GPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAK YVAELKEVVEED | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,512.053 | ||
| Theoretical pI: | 9.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 54.860 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.424 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142591.1 | internal | 132 | 396-1(-) |
Amino Acid sequence : | |||
| SSSTTSFSSATYLASASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLAS LPANNAYGPPGP | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,512.053 | ||
| Theoretical pI: | 9.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 54.860 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.424 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142591.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
| GPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAK YVAELKEVVEED | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,512.053 | ||
| Theoretical pI: | 9.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 54.860 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.424 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142591.1 | internal | 132 | 396-1(-) |
Amino Acid sequence : | |||
| SSSTTSFSSATYLASASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLAS LPANNAYGPPGP | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,512.053 | ||
| Theoretical pI: | 9.649 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 54.860 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.424 | ||
| sheet | 0.227 | ||