Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142591.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
GPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAK YVAELKEVVEED | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,512.053 | ||
Theoretical pI: | 9.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 54.860 | ||
aromaticity | 0.083 | ||
GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.424 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142591.1 | internal | 132 | 396-1(-) |
Amino Acid sequence : | |||
SSSTTSFSSATYLASASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLAS LPANNAYGPPGP | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,512.053 | ||
Theoretical pI: | 9.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 54.860 | ||
aromaticity | 0.083 | ||
GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.424 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142591.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
GPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAK YVAELKEVVEED | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,512.053 | ||
Theoretical pI: | 9.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 54.860 | ||
aromaticity | 0.083 | ||
GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.424 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142591.1 | internal | 132 | 396-1(-) |
Amino Acid sequence : | |||
SSSTTSFSSATYLASASPSPVGVSSSLAGVLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLAS LPANNAYGPPGP | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,512.053 | ||
Theoretical pI: | 9.649 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 54.860 | ||
aromaticity | 0.083 | ||
GRAVY | 0.139 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.424 | ||
sheet | 0.227 |