| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142607.1 | 3prime_partial | 118 | 45-398(+) |
Amino Acid sequence : | |||
| MESIPVIAKKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILG | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,470.060 | ||
| Theoretical pI: | 5.074 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 26.686 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.229 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142607.1 | 3prime_partial | 118 | 45-398(+) |
Amino Acid sequence : | |||
| MESIPVIAKKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILG | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,470.060 | ||
| Theoretical pI: | 5.074 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 26.686 | ||
| aromaticity | 0.051 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.229 | ||
| sheet | 0.246 | ||