Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142613.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
HGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,576.719 | ||
Theoretical pI: | 4.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 20.586 | ||
aromaticity | 0.079 | ||
GRAVY | 0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.277 | ||
sheet | 0.267 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142613.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
HGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,576.719 | ||
Theoretical pI: | 4.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 20.586 | ||
aromaticity | 0.079 | ||
GRAVY | 0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.277 | ||
sheet | 0.267 |