Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142615.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
AYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQ AEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,113.760 | ||
Theoretical pI: | 4.492 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 44.078 | ||
aromaticity | 0.078 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.211 | ||
turn | 0.205 | ||
sheet | 0.337 |