Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142621.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
ARAQREGAEVYTGTDLCKKKSIELLEELHLPRGLLPLENMEEVGFNRSSGFVWLRQKKKTDHVFKKIGKAVSYAPEVTALVEDRRMKKMTGVKTREMLIWLTLTDMYIEDPASGKITFRT PSGLGRSFPVTAFEEVAGEVEKKVEGEEVDK* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 15,737.848 | ||
Theoretical pI: | 6.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 63.659 | ||
aromaticity | 0.028 | ||
GRAVY | -1.285 | ||
Secondary Structure Fraction | |||
Helix | 0.154 | ||
turn | 0.287 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142621.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
TSTEGGRRSLHRHRPLQEEVHRAARGAPPATWPPSIGEHGGGRFQPVVRVRVAPAEEEDRPRVQEDREGRLLRPRGHGARGGPEDEEDDRCQDEGDADLAHAHGHVHRGPRLRENYLQDP VGAREELSCHGVRGGGWGSGEEG* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,737.848 | ||
Theoretical pI: | 6.048 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 63.659 | ||
aromaticity | 0.028 | ||
GRAVY | -1.285 | ||
Secondary Structure Fraction | |||
Helix | 0.154 | ||
turn | 0.287 | ||
sheet | 0.259 |