| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142623.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| FSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMA HFSDVAEAYIEK | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,269.462 | ||
| Theoretical pI: | 5.320 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 32.849 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.197 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142623.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| FSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMA HFSDVAEAYIEK | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,269.462 | ||
| Theoretical pI: | 5.320 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 32.849 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.197 | ||
| sheet | 0.280 | ||