Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142623.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
FSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMA HFSDVAEAYIEK | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 15,269.462 | ||
Theoretical pI: | 5.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 32.849 | ||
aromaticity | 0.098 | ||
GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.197 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142623.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
FSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMA HFSDVAEAYIEK | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 15,269.462 | ||
Theoretical pI: | 5.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 32.849 | ||
aromaticity | 0.098 | ||
GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.197 | ||
sheet | 0.280 |