Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142630.1 | internal | 163 | 491-3(-) |
Amino Acid sequence : | |||
DLLRELVGLHEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLDGDLGRVGT VLLEPEISVALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHG | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,570.621 | ||
Theoretical pI: | 7.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
Instability index: | 33.698 | ||
aromaticity | 0.061 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.221 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142630.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
TMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAANRCGSCRKKVGLTGFKCRCG ATYCGAHRYPETHACGFDYKAAGREAIARDNPLVKADKLSEKI | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,570.621 | ||
Theoretical pI: | 7.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
Instability index: | 33.698 | ||
aromaticity | 0.061 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.221 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142630.1 | internal | 163 | 491-3(-) |
Amino Acid sequence : | |||
DLLRELVGLHEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLDGDLGRVGT VLLEPEISVALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHG | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,570.621 | ||
Theoretical pI: | 7.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
Instability index: | 33.698 | ||
aromaticity | 0.061 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.221 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142630.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
TMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAANRCGSCRKKVGLTGFKCRCG ATYCGAHRYPETHACGFDYKAAGREAIARDNPLVKADKLSEKI | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,570.621 | ||
Theoretical pI: | 7.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
Instability index: | 33.698 | ||
aromaticity | 0.061 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.221 | ||
sheet | 0.282 |