| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142630.1 | internal | 163 | 491-3(-) |
Amino Acid sequence : | |||
| DLLRELVGLHEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLDGDLGRVGT VLLEPEISVALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHG | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,570.621 | ||
| Theoretical pI: | 7.979 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
| Instability index: | 33.698 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142630.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
| TMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAANRCGSCRKKVGLTGFKCRCG ATYCGAHRYPETHACGFDYKAAGREAIARDNPLVKADKLSEKI | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,570.621 | ||
| Theoretical pI: | 7.979 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
| Instability index: | 33.698 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142630.1 | internal | 163 | 491-3(-) |
Amino Acid sequence : | |||
| DLLRELVGLHEWVVTCDRLPPRRLVVEATRVGLRVAVGPAIGGPAPALEPGQPNLLPARPAPVRRHRLDHRRRFLRPNQNALLLLVRRGSGRVGRDDDGVSGDGRPHQRVLDGDLGRVGT VLLEPEISVALGAEVKGGWAAEKSAVVRAKPVTFSASLLFRHG | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,570.621 | ||
| Theoretical pI: | 7.979 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
| Instability index: | 33.698 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142630.1 | internal | 163 | 3-491(+) |
Amino Acid sequence : | |||
| TMAEEQRCGEGHRLCSNNCGFFGSPATLNLCSKCYRDFRFKEDRADSAKIAVKNSLMRTAVTADAVIVSSDSSASSPDEEEESVLVRAEEAAAVVQSVAANRCGSCRKKVGLTGFKCRCG ATYCGAHRYPETHACGFDYKAAGREAIARDNPLVKADKLSEKI | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,570.621 | ||
| Theoretical pI: | 7.979 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6585 | ||
| Instability index: | 33.698 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.202 | ||
| turn | 0.221 | ||
| sheet | 0.282 | ||