| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142637.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
| KAVSMADLEHAKDRIMMGSERKSAVISDESRKLTAYHEGGHALVAIHTDGALPVHKATIVPRGMSLGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLKQAT SLAKAMVTKYGMSKEVGLVTHNYHENGQSMS | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,229.392 | ||
| Theoretical pI: | 6.720 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 40.877 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.232 | ||
| sheet | 0.318 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142637.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
| KAVSMADLEHAKDRIMMGSERKSAVISDESRKLTAYHEGGHALVAIHTDGALPVHKATIVPRGMSLGMVSQLPDKDETSISRKQMLARLDVCMGGRVAEELIFGESEVTSGASSDLKQAT SLAKAMVTKYGMSKEVGLVTHNYHENGQSMS | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,229.392 | ||
| Theoretical pI: | 6.720 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 40.877 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.285 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.232 | ||
| sheet | 0.318 | ||