| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142646.1 | internal | 139 | 418-2(-) |
Amino Acid sequence : | |||
| GGPRNVQGKWSQDQKLFESWRDAKTGYPLIDANMKELSTTGFMSNRGRQIVCSFLVRDMGLDWRMGAEWYETCLLDYDPCSNYGNWTYGAGVGNDPREDRYFSIPKQAQNYDPEGEYVAF WLQQLRRLPKEKRHWPGRL | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 16,310.093 | ||
| Theoretical pI: | 7.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50545 | ||
| Instability index: | 29.995 | ||
| aromaticity | 0.144 | ||
| GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.259 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142646.1 | internal | 139 | 418-2(-) |
Amino Acid sequence : | |||
| GGPRNVQGKWSQDQKLFESWRDAKTGYPLIDANMKELSTTGFMSNRGRQIVCSFLVRDMGLDWRMGAEWYETCLLDYDPCSNYGNWTYGAGVGNDPREDRYFSIPKQAQNYDPEGEYVAF WLQQLRRLPKEKRHWPGRL | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 16,310.093 | ||
| Theoretical pI: | 7.868 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50545 | ||
| Instability index: | 29.995 | ||
| aromaticity | 0.144 | ||
| GRAVY | -0.921 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.259 | ||
| sheet | 0.209 | ||