Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142653.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
ERIECPIYDVVDKGNGFEIRRYNTTAWMSTSKIDDISLVAATRTGFLQLFEYIQGKNEYGVKIEMTSPVITEVSPSDGPFCTSSFIVSFFVPKKNQANTPPAKGLHVQKWGLKYAAVRQF GGFVADETLGEEAAALYSDLAGSNWASAVEKGRKAGPTSDYIVAQYNSPFEFSGRVNEIWMMF | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,309.691 | ||
Theoretical pI: | 5.273 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 41.207 | ||
aromaticity | 0.131 | ||
GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.257 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142653.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
ERIECPIYDVVDKGNGFEIRRYNTTAWMSTSKIDDISLVAATRTGFLQLFEYIQGKNEYGVKIEMTSPVITEVSPSDGPFCTSSFIVSFFVPKKNQANTPPAKGLHVQKWGLKYAAVRQF GGFVADETLGEEAAALYSDLAGSNWASAVEKGRKAGPTSDYIVAQYNSPFEFSGRVNEIWMMF | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,309.691 | ||
Theoretical pI: | 5.273 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 41.207 | ||
aromaticity | 0.131 | ||
GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.257 | ||
sheet | 0.224 |