| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142671.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| DRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,926.778 | ||
| Theoretical pI: | 9.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 11920 | ||
| Instability index: | 39.240 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.202 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142671.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| DRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,926.778 | ||
| Theoretical pI: | 9.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 11920 | ||
| Instability index: | 39.240 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.202 | ||
| sheet | 0.227 | ||