| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142676.1 | internal | 233 | 2-700(+) |
Amino Acid sequence : | |||
| HEPPPPPMPPPKPPSSNFGPRRMVLGCSNAGRLGSPRRQSGWPVVSTRSSSSASRPSSPRSFGEGEGYNSADEQAPCFVSSYDDAEREQMFEIEIRRTKGLEVKRMMEDGNCLFRAVADQ VYGDPEAYDMARQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQAFCEMYNRPIHIYCYSAEPINIFHGSYNTDTPPIRLSYHHGNHYNSLVDPRRVTIGAGL | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 11,521.320 | ||
| Theoretical pI: | 11.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 63.646 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.747 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142676.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| TSHHLRQCLLQNHRHLISVQGGWCWAARMLGGWDPQGGSRAGRLCRHGRRLLRLGRHHPGLSGKGKDTTAQMSRLLVLCHHMMMRRENKCLRLRSDAQRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,521.320 | ||
| Theoretical pI: | 11.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 63.646 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.747 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142676.1 | internal | 233 | 2-700(+) |
Amino Acid sequence : | |||
| HEPPPPPMPPPKPPSSNFGPRRMVLGCSNAGRLGSPRRQSGWPVVSTRSSSSASRPSSPRSFGEGEGYNSADEQAPCFVSSYDDAEREQMFEIEIRRTKGLEVKRMMEDGNCLFRAVADQ VYGDPEAYDMARQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNVEIQAFCEMYNRPIHIYCYSAEPINIFHGSYNTDTPPIRLSYHHGNHYNSLVDPRRVTIGAGL | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 11,521.320 | ||
| Theoretical pI: | 11.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 63.646 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.747 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142676.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| TSHHLRQCLLQNHRHLISVQGGWCWAARMLGGWDPQGGSRAGRLCRHGRRLLRLGRHHPGLSGKGKDTTAQMSRLLVLCHHMMMRRENKCLRLRSDAQRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,521.320 | ||
| Theoretical pI: | 11.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 63.646 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.747 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||